PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G285800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 277aa    MW: 29188.8 Da    PI: 7.9645
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G285800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.91.2e-183279148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg+WT+eEdell++av++ G g+W+t +r+ g+ R++k+c++rw +yl
  Sevir.5G285800.1.p 32 RGAWTPEEDELLARAVAREGEGRWRTLPRRAGLLRCGKSCRLRWMNYL 79
                        89******************************99************97 PP

2Myb_DNA-binding48.12.7e-1586130248
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         g+  ++E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++l
  Sevir.5G285800.1.p  86 GPIAADEEDLIVRLHRLLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 130
                         566689***************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.8242779IPR017930Myb domain
SuperFamilySSF466891.87E-2830126IPR009057Homeodomain-like
SMARTSM007171.4E-133181IPR001005SANT/Myb domain
PfamPF002491.7E-163279IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-213386IPR009057Homeodomain-like
CDDcd001672.49E-113479No hitNo description
PROSITE profilePS5129425.24280134IPR017930Myb domain
SMARTSM007176.2E-1484132IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.8E-2587135IPR009057Homeodomain-like
PfamPF002491.6E-1389130IPR001005SANT/Myb domain
CDDcd001674.57E-1190130No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MTRKQPAARR RGGGGGGGAV AGEGTTRAAL KRGAWTPEED ELLARAVARE GEGRWRTLPR  60
RAGLLRCGKS CRLRWMNYLR PDIKRGPIAA DEEDLIVRLH RLLGNRWSLI AGRLPGRTDN  120
EIKNYWNSHL SKKLIARGID PRTHTPLAAA AAPAPDKTPP PPPAVKPKPP VAPPPPPPPE  180
QPGSSSGAGG VGDDDDGGRD FPAMTGLGAD VFEGLDDPFC ALDAAGRGGF GMGCAMVDDG  240
TFSSFLDSLV SENQLAYYFG DHKNAEGGDN DDQAGA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-24301345108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1082591e-136AK108259.1 Oryza sativa Japonica Group cDNA clone:002-141-A12, full insert sequence.
GenBankD886201e-136D88620.1 Oryza sativa mRNA for OSMYB4, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014660709.11e-136PREDICTED: transcription repressor MYB5-like
SwissprotQ388504e-70MYB5_ARATH; Transcription repressor MYB5
TrEMBLK3XQX71e-137K3XQX7_SETIT; Uncharacterized protein
STRINGSi004316m1e-137(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP11637448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13540.12e-65myb domain protein 5